| Edit |   |
|---|
| Antigenic Specificity | Family with Sequence Similarity 105, Member A (FAM105A) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | FAM105A belongs to the FAM105 family. The exact function of FAM105A remains unknown. |
|---|
| Immunogen | FAM105 A antibody was raised using the N terminal of FAM105 corresponding to a region with amino acids HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE |
|---|
| Other Names | NET20|9830126M18 |
|---|
| Gene, Accession # | Gene ID: 54491 |
|---|
| Catalog # | ABIN635319 |
|---|
| Price | |
|---|
| Order / More Info | Family with Sequence Similarity 105, Member A (FAM105A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|