| Edit |   |
|---|
| Antigenic Specificity | Family with Sequence Similarity 129, Member A (FAM129A) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker. |
|---|
| Immunogen | FAM129 A antibody was raised using the N terminal of FAM129 corresponding to a region with amino acids SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE |
|---|
| Other Names | C1orf24|NIBAN|AI256368|AU019833|Niban |
|---|
| Gene, Accession # | Gene ID: 116496 |
|---|
| Catalog # | ABIN629867 |
|---|
| Price | |
|---|
| Order / More Info | Family with Sequence Similarity 129, Member A (FAM129A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|