| Edit |   |
|---|
| Antigenic Specificity | Family with Sequence Similarity 176, Member A (FAM176A) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TMEM166 belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. |
|---|
| Immunogen | TMEM166 antibody was raised using the N terminal Of Tmem166 corresponding to a region with amino acids RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA |
|---|
| Other Names | Fam176a|RGD1559797|Tmem166|FAM176A|TMEM166|BC014699 |
|---|
| Gene, Accession # | Gene ID: 84141 |
|---|
| Catalog # | ABIN635222 |
|---|
| Price | |
|---|
| Order / More Info | Family with Sequence Similarity 176, Member A (FAM176A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|