| Edit |   |
|---|
| Antigenic Specificity | Family with Sequence Similarity 46, Member C (FAM46C) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | FAM46C belongs to the FAM46 family. The exact function of FAM46C remains unknown. |
|---|
| Immunogen | FAM46 C antibody was raised using the middle region of FAM46 corresponding to a region with amino acids LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP |
|---|
| Other Names | 4930431B09Rik|AI449797|fd14g08|wu:fc56d11|wu:fd14g08|zgc:55510|zgc:66197 |
|---|
| Gene, Accession # | Gene ID: 54855 |
|---|
| Catalog # | ABIN632520 |
|---|
| Price | |
|---|
| Order / More Info | Family with Sequence Similarity 46, Member C (FAM46C) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|