| Edit |   |
|---|
| Antigenic Specificity | Family with Sequence Similarity 71, Member D (FAM71D) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of FAM71 protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | FAM71 D antibody was raised using the middle region of FAM71 corresponding to a region with amino acids VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN |
|---|
| Other Names | GARI-L2|4921509E07Rik|4930516C23Rik|C14orf54|C10H14orf54 |
|---|
| Gene, Accession # | Gene ID: 161142 |
|---|
| Catalog # | ABIN633553 |
|---|
| Price | |
|---|
| Order / More Info | Family with Sequence Similarity 71, Member D (FAM71D) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|