| Edit |   |
|---|
| Antigenic Specificity | Motile Sperm Domain Containing 3 (MOSPD3) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MOSPD3 is a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neonatal lethality. |
|---|
| Immunogen | MOSPD3 antibody was raised using the C terminal of MOSPD3 corresponding to a region with amino acids FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM |
|---|
| Other Names | cds3|MGC89012|MOSPD3|CDS3|NET30|1190005J19Rik|5133401H10Rik|Gtig2|R124 |
|---|
| Gene, Accession # | Gene ID: 64598,68929 |
|---|
| Catalog # | ABIN630396 |
|---|
| Price | |
|---|
| Order / More Info | Motile Sperm Domain Containing 3 (MOSPD3) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|