| Edit |   |
|---|
| Antigenic Specificity | Motilin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Motilin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Motilin. This antibody reacts with human. The Motilin Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MLN(motilin) The peptide sequence was selected from the middle region of MLN. Peptide sequence LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE. |
|---|
| Other Names | MGC138519, motilin, prepromotilin, promotilin |
|---|
| Gene, Accession # | MLN, Gene ID: 4295, Accession: P12872, SwissProt: P12872 |
|---|
| Catalog # | NBP1-59344-20ul |
|---|
| Price | |
|---|
| Order / More Info | Motilin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|