| Edit |   |
| Antigenic Specificity | Motilin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Motilin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Motilin. This antibody reacts with human. The Motilin Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MLN(motilin) The peptide sequence was selected from the middle region of MLN. Peptide sequence LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE. |
| Other Names | MGC138519, motilin, prepromotilin, promotilin |
| Gene, Accession # | MLN, Gene ID: 4295, Accession: P12872, SwissProt: P12872 |
| Catalog # | NBP1-59344 |
| Price | |
| Order / More Info | Motilin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |