| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 41, Member 3 (SLC41A3) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC41A3 is a multi-pass membrane protein. It belongs to the SLC41A transporter family. The exact function of SLC41A3 remains unknown. |
|---|
| Immunogen | SLC41 A3 antibody was raised using the C terminal of SLC41 3 corresponding to a region with amino acids WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI |
|---|
| Other Names | slc41a1-l2|slc41a3.2|SLC41A1-L2|1010001P06Rik|AI480742 |
|---|
| Gene, Accession # | Gene ID: 54946 |
|---|
| Catalog # | ABIN635242 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 41, Member 3 (SLC41A3) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|