| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 45, Member 2 (SLC45A2) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC45A2 is a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4. |
|---|
| Immunogen | SLC45 A2 antibody was raised using the C terminal of SLC45 2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC |
|---|
| Other Names | SLC45A2|matp|aim1|im:7138762|MGC114950|1A1|AIM1|MATP|OCA4|SHEP5|Aim-1|Aim1|Dbr|Matp|blanc-sale|bls|uw |
|---|
| Gene, Accession # | Gene ID: 51151 |
|---|
| Catalog # | ABIN635265 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 45, Member 2 (SLC45A2) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|