| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 25, Member 32 (SLC25A32) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria. |
|---|
| Immunogen | SLC25 A32 antibody was raised using the middle region of SLC25 32 corresponding to a region with amino acids NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID |
|---|
| Other Names | fi40c12|mftc|wu:fi40c12|zgc:55610|zgc:110786|RGD1565789|MFT|MFTC|2610043O12Rik|Mftc |
|---|
| Gene, Accession # | Gene ID: 81034,69906,315023 |
|---|
| Catalog # | ABIN635047 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 25, Member 32 (SLC25A32) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|