| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 38 Member 4 (SLC38A4) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, dog, C. elegans, Drosophila, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent. |
|---|
| Immunogen | SLC38 A4 antibody was raised using the middle region of SLC38 4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV |
|---|
| Other Names | wu:fd51c05|zgc:103694|zgc:113830|SLC38A4|ATA3|SNAT4|NAT3|PAAT|1110012E16Rik|1700012A18Rik|Ata3|mATA3|mNAT3 |
|---|
| Gene, Accession # | Gene ID: 449771,55089,486595,69354,170573 |
|---|
| Catalog # | ABIN629787 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 38 Member 4 (SLC38A4) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|