| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 25, Member 35 (SLC25A35) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC25A35 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. It is a multi-pass membrane protein. The functions of SLC25A35 remain unknown.SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins. |
|---|
| Immunogen | SLC25 A35 antibody was raised using the N terminal of SLC25 35 corresponding to a region with amino acids DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFI |
|---|
| Other Names | si:ch211-268m12.5|1810012H11Rik |
|---|
| Gene, Accession # | Gene ID: 399512,71998,497933 |
|---|
| Catalog # | ABIN635087 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 25, Member 35 (SLC25A35) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|