| Edit |   |
| Antigenic Specificity | Solute Carrier Family 38 Member 3 (SLC38A3) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognises histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and play a role in nitrogen metabolism and synaptic transmission. |
| Immunogen | SLC38 A3 antibody was raised using the N terminal of SLC38 3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM |
| Other Names | slc38a3|wu:fc31c02|wu:fc48a10|zgc:92015|MGC69392|G17|NAT1|SN1|0610012J02Rik|D9Ucla2|Nat1|Slc38-3|Sn1|Snat3|mNAT |
| Gene, Accession # | Gene ID: 10991,76257 |
| Catalog # | ABIN635610 |
| Price | |
| Order / More Info | Solute Carrier Family 38 Member 3 (SLC38A3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |