| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 41, Member 2 (SLC41A2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC41A2 acts as a plasma-membrane magnesium transporter. |
|---|
| Immunogen | SLC41 A2 antibody was raised using the N terminal of SLC41 2 corresponding to a region with amino acids SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK |
|---|
| Other Names | MGC83802|slc41a1-l1|SLC41A1-L1|A230035L05Rik |
|---|
| Gene, Accession # | Gene ID: 84102 |
|---|
| Catalog # | ABIN630335 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 41, Member 2 (SLC41A2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|