| Edit |   |
|---|
| Antigenic Specificity | SYPL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 61%, rat 70%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human SYPL1 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ATGHNIIDELPPCKKKAVLCYFGSVTSMGS |
|---|
| Other Names | synaptophysin-like 1, SYPL |
|---|
| Gene, Accession # | Gene ID: 6856, UniProt: Q16563, ENSG00000008282 |
|---|
| Catalog # | HPA014141 |
|---|
| Price | |
|---|
| Order / More Info | SYPL1 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|