| Edit |   |
|---|
| Antigenic Specificity | LOC203547 (LOC203547) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of LOC203547 protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | LOC203547 antibody was raised using the N terminal of LOC203547 corresponding to a region with amino acids MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN630379 |
|---|
| Price | |
|---|
| Order / More Info | LOC203547 (LOC203547) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|