| Edit |   |
|---|
| Antigenic Specificity | DCTP Pyrophosphatase 1 (DCTPP1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity and pyrimidine deoxyribonucleotide binding. |
|---|
| Immunogen | XTP3 TPA antibody was raised using the middle region of XTP3 PA corresponding to a region with amino acids KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST |
|---|
| Other Names | xtp3tpa|RS21C6|XTP3TPA|RS21-C6|2410015N17Rik|AI854235|Rs21c6|Xtp3tpa |
|---|
| Gene, Accession # | Gene ID: 79077 |
|---|
| Catalog # | ABIN632345 |
|---|
| Price | |
|---|
| Order / More Info | DCTP Pyrophosphatase 1 (DCTPP1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|