| Edit |   |
|---|
| Antigenic Specificity | Developmental Pluripotency Associated 5 (DPPA5) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs. |
|---|
| Immunogen | DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV |
|---|
| Other Names | ESG1|AA536857|Dppa5|Esg1|ecat2 |
|---|
| Gene, Accession # | Gene ID: 340168 |
|---|
| Catalog # | ABIN630614 |
|---|
| Price | |
|---|
| Order / More Info | Developmental Pluripotency Associated 5 (DPPA5) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|