| Edit |   |
|---|
| Antigenic Specificity | Acetyl-CoA Acyltransferase 2 (ACAA2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. |
|---|
| Immunogen | ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV |
|---|
| Other Names | DSAEC|0610011L04Rik|AI255831|AI265397|D18Ertd240e |
|---|
| Gene, Accession # | Gene ID: 10449,52538,170465 |
|---|
| Catalog # | ABIN631066 |
|---|
| Price | |
|---|
| Order / More Info | Acetyl-CoA Acyltransferase 2 (ACAA2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|