| 产品详情 |
| Edit |   |
| Antigenic Specificity | AKR1B10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband™ antibody for Aldo-keto reductase family 1 member B10(AKR1B10) detection. Tested with WB, IHC-P in Human. No cross reactivity with other proteins. Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY). |
| Other Names | Aldo-keto reductase family 1 member B10;1.1.1.-;ARL-1;Aldose reductase-like;Aldose reductase-related protein;ARP;hARP;Small intestine reductase;SI reductase;AKR1B10;AKR1B11; |
| Gene, Accession # | AKR1B10, UniProt: O60218 |
| Catalog # | A02976 |
| Price | |
| Order / More Info | AKR1B10 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 产品资料 |
|
|