| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KAT2A/GCN5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KAT2A/GCN5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KAT2A/GCN5. This antibody reacts with human. The KAT2A/GCN5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KAT2A/GCN5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYK |
|---|
| Other Names | EC 2.3.1.48, GCN5 general control of amino-acid synthesis 5-like 2 (yeast), GCN5L2GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2, GCN5MGC102791, General control of amino acid synthesis protein 5-like 2, General control of amino acid synthesis, yeast, homolog-like 2, HGCN5, Histone acetyltransferase GCN5, histone acetyltransferase KAT2A, HsGCN5, K(lysine) acetyltransferase 2A, Lysine acetyltransferase 2A, PCAF-b, STAF97 |
|---|
| Gene, Accession # | KAT2A, Gene ID: 2648 |
|---|
| Catalog # | NBP2-14140 |
|---|
| Price | |
|---|
| Order / More Info | KAT2A/GCN5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|