| Edit |   |
| Antigenic Specificity | N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 3 (NDST3) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | NDST3 is a member of the heparan sulfate/heparin GlcNAc N-deacetylase/ N-sulfotransferase family. NDST3 is a type II transmembrane protein that resides in the Golgi apparatus. This monomeric bifunctional enzyme catalyzes the N-deacetylation and N-sulfation of N-acetylglucosamine residues in heparan sulfate and heparin, which are the initial chemical modifications required for the biosynthesis of the functional oligosaccharide sequences that define the specific ligand binding activities of heparan sulfate and heparin. |
| Immunogen | NDST3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDLGLHD |
| Other Names | NDST3|HSST3|4921531K01Rik|4930511P15Rik |
| Gene, Accession # | Gene ID: 9348,83398,295430 |
| Catalog # | ABIN635893 |
| Price | |
| Order / More Info | N-Deacetylase/N-Sulfotransferase (Heparan Glucosaminyl) 3 (NDST3) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |