| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | N-Deacetylase/N-Sulfotransferase 1/NDST1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to N-Deacetylase/N-Sulfotransferase 1/NDST1. This antibody reacts with human. The N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human N-Deacetylase/N-Sulfotransferase 1/NDST1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YEPVLLAKTRSSESIPHLGADAGLHAALHATVVQ |
|---|
| Other Names | [Heparan sulfate]-glucosamine N-sulfotransferase 1, bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1, EC 2.8.2.8, Glucosaminyl N-deacetylase/N-sulfotransferase 1, heparan sulfate-N-deacetylase/N-sulfotransferase, HSNST 1, HSST1, HSSTN-HSST 1, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1, NDST-1, N-heparan sulfate sulfotransferase 1, NST1 |
|---|
| Gene, Accession # | NDST1, Gene ID: 3340, Accession: P52848, SwissProt: P52848 |
|---|
| Catalog # | NBP2-37978 |
|---|
| Price | |
|---|
| Order / More Info | N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|