| 产品详情 |
| Edit |   |
| Antigenic Specificity | DBR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DBR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DBR1. This antibody reacts with human. The DBR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human DBR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SALSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTV |
| Other Names | debranching enzyme (S. Cerevisiae) homolog 1, debranching enzyme homolog 1 (S. cerevisiae), EC 3.1, lariat debranching enzyme, RNA lariat debranching enzyme |
| Gene, Accession # | DBR1, Gene ID: 51163 |
| Catalog # | NBP1-85907 |
| Price | |
| Order / More Info | DBR1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|