| 产品详情 |
| Edit |   |
| Antigenic Specificity | PTEN |
| Clone | 1C3 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PTEN Antibody (1C3) from Novus Biologicals is a mouse monoclonal antibody to PTEN. This antibody reacts with human. The PTEN Antibody (1C3) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunoprecipitation. |
| Immunogen | PTEN (NP_000305.1, 2 a.a. - 91 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFE |
| Other Names | BZS, EC 3.1.3.16,10q23del, EC 3.1.3.48, EC 3.1.3.67, GLM2, MMAC1 phosphatase and tensin homolog deleted on chromosome 10, MMAC1MGC11227, Mutated in multiple advanced cancers 1, phosphatase and tensin homologDEC, phosphatidylinositol-34,5-trisphosphate 3-phosphatase and dual-specificityprotein phosphatase PTEN, PTEN1, TEP1MHAM |
| Gene, Accession # | PTEN, Gene ID: 5728, Accession: NP_000305, SwissProt: NP_000305 |
| Catalog # | H00005728-M13 |
| Price | |
| Order / More Info | PTEN Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|