| Edit |   |
|---|
| Antigenic Specificity | MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap. |
|---|
| Immunogen | MKNK2 antibody was raised using the N terminal of MKNK2 corresponding to a region with amino acids SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL |
|---|
| Other Names | gprk7|mnk2|GPRK7|MNK2|2010016G11Rik|Gprk7|Mnk2|mknk2|wu:fb37e05|wz5090 |
|---|
| Gene, Accession # | Gene ID: 2872,17347,299618 |
|---|
| Catalog # | ABIN634405 |
|---|
| Price | |
|---|
| Order / More Info | MAP Kinase Interacting serine/threonine Kinase 2 (MKNK2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|