| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ets-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ets-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ets-1. This antibody reacts with human. The Ets-1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Ets-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS |
|---|
| Other Names | Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1, ets protein, ETS-1, EWSR2, FLJ10768, p54, protein C-ets-1, v-ets avian erythroblastosis virus E2 oncogene homolog 1, v-ets avian erythroblastosis virus E26 oncogene homolog 1, v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) |
|---|
| Gene, Accession # | ETS1, Gene ID: 2113 |
|---|
| Catalog # | NBP2-56897 |
|---|
| Price | |
|---|
| Order / More Info | Ets-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|