| Edit |   |
|---|
| Antigenic Specificity | Lipocalin 6 (LCN6) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LCN6 may play a role in male fertility. |
|---|
| Immunogen | Lipocalin 6 antibody was raised using the middle region of LCN6 corresponding to a region with amino acids LWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSR |
|---|
| Other Names | LCN5|UNQ643|hLcn5|9230101D24Rik |
|---|
| Gene, Accession # | Gene ID: 158062 |
|---|
| Catalog # | ABIN633968 |
|---|
| Price | |
|---|
| Order / More Info | Lipocalin 6 (LCN6) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|