| Edit |   |
| Antigenic Specificity | NECAB1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 97%, rat 98%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human NECAB1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFH |
| Other Names | N-terminal EF-hand calcium binding protein 1, EFCBP1 |
| Gene, Accession # | Gene ID: 64168, UniProt: Q8N987, ENSG00000123119 |
| Catalog # | HPA031262 |
| Price | |
| Order / More Info | NECAB1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |