| Edit |   |
|---|
| Antigenic Specificity | Myozenin 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Myozenin 1 antibody. Specificity: Myozenin 1 antibody was raised against the middle region of MYOZ1 |
|---|
| Immunogen | Myozenin 1 antibody was raised using the middle region of MYOZ1 corresponding to a region with amino acids TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY |
|---|
| Other Names | myozenin-1; Myozenin-1; myozenin-1; myozenin 1; Calsarcin-2; Filamin-, actinin- and telethonin-binding protein; Protein FATZ, MYOZ1; MYOZ1; CS-2; FATZ; MYOZ |
|---|
| Gene, Accession # | Gene ID: 58529, NCBI: NP_067068.1 |
|---|
| Catalog # | MBS5301559 |
|---|
| Price | |
|---|
| Order / More Info | Myozenin 1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|