| Edit |   |
|---|
| Antigenic Specificity | OTC/Ornithine Carbamoyltransferase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-OTC/Ornithine Carbamoyltransferase Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human OTC (33-70aa NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK), different from the related mouse and rat sequences by three amino acids.Subcellular Localization: Mitochondrion matrix.Tissue Specificity: Mainly expressed in liver and |
|---|
| Other Names | ornithine carbamoyltransferase, mitochondrial; Ornithine carbamoyltransferase, mitochondrial; Ornithine transcarbamylase; OTCase, OTC; OTCase |
|---|
| Gene, Accession # | OTC, Gene ID: 5009, NCBI: NP_000522.3, UniProt: P00480 |
|---|
| Catalog # | MBS1750467 |
|---|
| Price | |
|---|
| Order / More Info | OTC/Ornithine Carbamoyltransferase Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|