| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Otoferlin |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Otoferlin Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Otoferlin (1831-1863aa QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ), identical to the related mouse and rat sequences.Ig Type: Rabbit IgG |
|---|
| Other Names | otoferlin isoform e; Otoferlin; otoferlin; otoferlin; Fer-1-like protein 2, OTOF; OTOF; AUNB1; DFNB6; DFNB9; NSRD9; FER1L2; FER1L2 |
|---|
| Gene, Accession # | Gene ID: 9381, NCBI: NP_001274418.1, UniProt: Q9HC10 |
|---|
| Catalog # | MBS177788 |
|---|
| Price | |
|---|
| Order / More Info | Otoferlin Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: OTOF otoferlin. 2. Rodriguez-Ballesteros M, Reynoso R, Olarte M, Villamar M, Morera C, Santarelli R, Arslan E, Meda C, Curet C, Volter C, Sainz-Quevedo M, Castorina P, Ambrosetti U, Berrettini S, Frei K, Tedin S, Smith J, Cruz Tapia M, Cavalle L, Gelvez N, Primignani P, Gomez-Rosas E, Martin M, Moreno-Pelayo MA, Tamayo M, Moreno-Barral J, Moreno F, del Castillo I (May 2008). A multicenter study on the prevalence and spectrum of mutations in the otoferlin gene (OTOF) in subject |
|---|
| 产品资料 |
|
|