| Edit |   |
| Antigenic Specificity | Glycogen Phosphorylase BB/GPBB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Glycogen Phosphorylase BB/GPBB Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glycogen Phosphorylase BB/GPBB. This antibody reacts with human. The Glycogen Phosphorylase BB/GPBB Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PYGB(phosphorylase, glycogen; brain) The peptide sequence was selected from the N terminal of PYGB. Peptide sequence ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT. |
| Other Names | Brain glycogen phosphorylase, EC 2.4.1.1, Glycogen phosphorylase B, Glycogen phosphorylase brain form, Glycogen Phosphorylase Isoenzyme BB, MGC9213, Phosphorylase glycogen brain, PYGB |
| Gene, Accession # | PYGB, Gene ID: 5834, Accession: P11216, SwissProt: P11216 |
| Catalog # | NBP1-54966-20ul |
| Price | |
| Order / More Info | Glycogen Phosphorylase BB/GPBB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |