| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Galectin 8 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Galectin 8 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | galectin-8 isoform a; Galectin-8; galectin-8; galectin 8; Po66 carbohydrate-binding protein; Po66-CBP; Prostate carcinoma tumor antigen 1; PCTA-1, LGALS8; LGALS8; Gal-8; PCTA1; PCTA-1; Po66-CBP; Gal-8; Po66-CBP; PCTA-1 |
|---|
| Gene, Accession # | Gene ID: 3964, NCBI: NP_006490.3, UniProt: O00214 |
|---|
| Catalog # | MBS178158 |
|---|
| Price | |
|---|
| Order / More Info | Galectin 8 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: LGALS8 lectin, galactoside-binding, soluble, 8 (galectin 8). 2. Hadari YR, Paz K, Dekel R, Mestrovic T, Accili D, Zick Y (Mar 1995). Galectin-8. A new rat lectin, related to galectin-4. J Biol Chem 270 (7): 3447-53. 3. Su ZZ, Lin J, Shen R, Fisher PE, Goldstein NI, Fisher PB (Aug 1996). Surface-epitope masking and expression cloning identifies the human prostate carcinoma tumor antigen gene PCTA-1 a member of the galectin gene family. Proc Natl Acad Sci U S A 93 (14): 7252- |
|---|
| 产品资料 |
|
|