| Edit |   |
|---|
| Antigenic Specificity | galectin 9 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | rat predicted to work with: human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-galectin 9 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human galectin 9 (322-355aa DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | galectin-9 isoform short; Galectin-9; galectin-9; galectin 9; Ecalectin; Tumor antigen HOM-HD-21, LGALS9; LGALS9; HUAT; LGALS9A; Gal-9 |
|---|
| Gene, Accession # | Gene ID: 3965, NCBI: NP_002299.2, UniProt: O00182 |
|---|
| Catalog # | MBS178073 |
|---|
| Price | |
|---|
| Order / More Info | galectin 9 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: LGALS9 lectin, galactoside-binding, soluble, 9 (galectin 9). 2. Tureci O, Schmitt H, Fadle N, Pfreundschuh M, Sahin U (Apr 1997). Molecular definition of a novel human galectin which is immunogenic in patients with Hodgkin's disease. J Biol Chem 272 (10): 6416-22. |
|---|