| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CDK6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Cdk6 Antibody. Reactivity: Human, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Cdk6 (119-150aa TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN), identical to the related mouse sequence. |
|---|
| Other Names | cyclin-dependent kinase 6; Cyclin-dependent kinase 6; cyclin-dependent kinase 6; cyclin dependent kinase 6; Cell division protein kinase 6; Serine/threonine-protein kinase PLSTIRE, CDK6; CDK6; MCPH12; PLSTIRE; CDKN6 |
|---|
| Gene, Accession # | CDK6, Gene ID: 1021, NCBI: NP_001138778.1, UniProt: Q00534 |
|---|
| Catalog # | MBS178495 |
|---|
| Price | |
|---|
| Order / More Info | CDK6 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Lena, A. M., Mancini, M., Rivetti di Val Cervo, P. R., Saintigny, G., Mahe, C., Melino, G., Candi, E. MicroRNA-191 triggers keratinocytes senescence by SATB1 and CDK6 downregulation. Biochem. Biophys. Res. Commun. 423: 509-514, 2012. 2. Lien, H.-C., Lin, C.-W., Huang, P.-H., Chang, M.-L., Hsu, S.-M. Expression of cyclin-dependent kinase 6 (cdk6) and frequent loss of CD44 in nasal-nasopharyngeal NK/T-cell lymphomas: comparison with CD56-negative peripheral T-cell lymphomas. Lab. Invest. 80: |
|---|
| 产品资料 |
|
|