| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EIF2C1/AGO1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Flow Cytometry (FC/FACS), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-EIF2C1/AGO1 Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human EIF2C1/AGO1 (376-409aa EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR), identical to the related mouse and rat sequences.Subcellular Localization: Cytoplasm, P-body. |
|---|
| Other Names | protein argonaute-1 isoform 1x; Protein argonaute-1; protein argonaute-1; argonaute 1, RISC catalytic component; Argonaute RISC catalytic component 1; Eukaryotic translation initiation factor 2C 1; eIF-2C 1; eIF2C 1; Putative RNA-binding protein Q99, AGO1; AGO1; Q99; EIF2C; hAgo1; EIF2C1; GERP95; EIF2C1; Argonaute1; hAgo1; eIF-2C 1; eIF2C 1 |
|---|
| Gene, Accession # | EIF2C1/AGO1, Gene ID: 26523, NCBI: NP_001304051.1, UniProt: Q9UL18 |
|---|
| Catalog # | MBS1750490 |
|---|
| Price | |
|---|
| Order / More Info | EIF2C1/AGO1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|