| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CD26 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-CD26 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CD26 (731-761aa QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ), different from the related mouse and rat sequences by three amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | dipeptidyl peptidase 4; Dipeptidyl peptidase 4; dipeptidyl peptidase 4; dipeptidyl peptidase 4; ADABP; Adenosine deaminase complexing protein 2; ADCP-2, DPP4; DPP4; CD26; ADABP; ADCP2; DPPIV; TP103; ADCP2; CD26; ADCP-2; DPP IV |
|---|
| Gene, Accession # | CD26, Gene ID: 1803, NCBI: NP_001926.2, UniProt: P27487 |
|---|
| Catalog # | MBS177941 |
|---|
| Price | |
|---|
| Order / More Info | CD26 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Barnett A (Nov 2006). DPP-4 inhibitors and their potential role in the management of type 2 diabetes.International Journal of Clinical Practice60 (11): 1454-70. 2. Kameoka J, Tanaka T, Nojima Y, Schlossman SF, Morimoto C (Jul 1993). Direct association of adenosine deaminase with a T cell activation antigen, CD26.Science 261 (5120): 466-9. 3. Pro B, Dang NH (Oct 2004). CD26/dipeptidyl peptidase IV and its role in cancer. Histology and Histopathology 19 (4): 1345-51. |
|---|
| 产品资料 |
|
|