| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BAT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BAT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BAT2. This antibody reacts with human. The BAT2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human BAT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TDRGTEPGPIRPSHRPGPPVQFGTSDKDSDLRLVVGDSLKAEKELTASVTEAIPVSRDWELLPSAAASAEPQSKNLDSGHCVPEPSSSGQ |
|---|
| Other Names | BAT2DKFZp686D09175, D6S51ED6S51, G2HLA-B-associated transcript 2, HLA-B associated transcript 2, Large proline-rich protein BAT2, Proline-rich and coiled-coil-containing protein 2A, proline-rich coiled-coil 2A, Protein G2 |
|---|
| Gene, Accession # | PRRC2A, Gene ID: 7916, Accession: P48634, SwissProt: P48634 |
|---|
| Catalog # | NBP2-33471 |
|---|
| Price | |
|---|
| Order / More Info | BAT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|