| Edit |   |
|---|
| Antigenic Specificity | LETM2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LETM2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LETM2. This antibody reacts with human. The LETM2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LETM2(leucine zipper-EF-hand containing transmembrane protein 2) The peptide sequence was selected from the N terminal of LETM2. Peptide sequence KNYESKKYSDPSQPGNTVLHPGTRLIQKLHTSTCWLQEVPGKPQLEQATK. |
|---|
| Other Names | FLJ25409, LETM1 and EF-hand domain-containing protein 2, LETM1 domain-containing protein LETM2, mitochondrial, leucine zipper-EF-hand containing transmembrane protein 1-like protein, leucine zipper-EF-hand containing transmembrane protein 2, Leucine zipper-EF-hand-containing transmembrane protein 1-like |
|---|
| Gene, Accession # | LETM2, Gene ID: 137994, Accession: Q2VYF4-3, SwissProt: Q2VYF4-3 |
|---|
| Catalog # | NBP1-56618 |
|---|
| Price | |
|---|
| Order / More Info | LETM2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|