| Edit |   |
|---|
| Antigenic Specificity | UPF3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | UPF3A antibody |
|---|
| Immunogen | UPF3A antibody was raised using a synthetic peptide corresponding to a region with amino acids QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG |
|---|
| Other Names | UPF3A protein; Regulator of nonsense transcripts 3A; regulator of nonsense transcripts 3A; UPF3 regulator of nonsense transcripts homolog A (yeast); Nonsense mRNA reducing factor 3A; Up-frameshift suppressor 3 homolog A; hUpf3, UPF3A; UPF3A; UPF3; HUPF3A; RENT3A; RENT3A; UPF3; hUpf3 |
|---|
| Gene, Accession # | UPF3A, Gene ID: 65110, NCBI: AAH08694.1 |
|---|
| Catalog # | MBS5300566 |
|---|
| Price | |
|---|
| Order / More Info | UPF3A Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|