| Edit |   |
|---|
| Antigenic Specificity | UPP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | UPP1 antibody. Specificity: UPP1 antibody was raised against the N terminal of UPP1 |
|---|
| Immunogen | UPP1 antibody was raised using the N terminal of UPP1 corresponding to a region with amino acids AATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFG |
|---|
| Other Names | UPP1; UPP1; UPP 1; UPP-1; UDRPASE; UP; UPASE; UPP; UPP1; Uridine Phosphorylase 1, |
|---|
| Gene, Accession # | UPP1 |
|---|
| Catalog # | MBS5301610 |
|---|
| Price | |
|---|
| Order / More Info | UPP1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|