| Edit |   |
|---|
| Antigenic Specificity | Connexin 32/GJB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse, rat predicted human |
|---|
| Isotype | n/a |
|---|
| Format | n/a |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Connexin 32/GJB1 Picoband antibody. Reactivity: Mouse, Rat Predicted Reactivity: Human No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human Connexin 32/GJB1 (AMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVH).Subcellular Localization: Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. |
|---|
| Other Names | gap junction beta-1 protein; Gap junction beta-1 protein; gap junction beta-1 protein; gap junction protein beta 1; Connexin-32; Cx32; GAP junction 28 kDa liver protein, GJB1; GJB1; CMTX; CX32; CMTX1; CX32; Cx32 |
|---|
| Gene, Accession # | GJB1, Gene ID: 2705, NCBI: NP_000157.1, UniProt: P08034 |
|---|
| Catalog # | MBS1750553 |
|---|
| Price | |
|---|
| Order / More Info | Connexin 32/GJB1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|