| Edit |   |
|---|
| Antigenic Specificity | Adhesion Molecule with Ig-Like Domain 3 (AMIGO3) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain. |
|---|
| Immunogen | AMIGO3 antibody was raised using the N terminal of AMIGO3 corresponding to a region with amino acids MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL |
|---|
| Other Names | E430002N15Rik|ali3|mKIAA1851|AMIGO-3 |
|---|
| Gene, Accession # | Gene ID: 386724 |
|---|
| Catalog # | ABIN635891 |
|---|
| Price | |
|---|
| Order / More Info | Adhesion Molecule with Ig-Like Domain 3 (AMIGO3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|