| Edit |   |
| Antigenic Specificity | Kallikrein-Related Peptidase 13 (KLK13) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined. |
| Immunogen | KLK13 antibody was raised using the middle region of KLK13 corresponding to a region with amino acids VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLN |
| Other Names | Egfbp-2|mGk-13|KLK-L4|KLKL4 |
| Gene, Accession # | Gene ID: 26085 |
| Catalog # | ABIN631838 |
| Price | |
| Order / More Info | Kallikrein-Related Peptidase 13 (KLK13) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |