| Edit |   |
|---|
| Antigenic Specificity | RABL3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RABL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RABL3. This antibody reacts with human. The RABL3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RABL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LAEDFNPEEINLDCTNPRYLAAGSSNAVKLSRFFDKVIEKRYFLREGNQIPGFPDRKRFGAGTLKSLHYD |
|---|
| Other Names | MGC23920, RAB, member of RAS oncogene family-like 3, rab-like protein 3 |
|---|
| Gene, Accession # | RABL3, Gene ID: 285282, Accession: Q5HYI8 |
|---|
| Catalog # | NBP1-81160 |
|---|
| Price | |
|---|
| Order / More Info | RABL3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|