| Edit |   |
|---|
| Antigenic Specificity | RABL4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RABL4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RABL4. This antibody reacts with human. The RABL4 Antibody has been validated for the following applications: Western Blot. Specificity of human RABL4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEV |
|---|
| Other Names | intraflagellar transport 27 homolog (Chlamydomonas), intraflagellar transport protein 27 homolog, member of RAS oncogene family-like 4, Putative GTP-binding protein RAY-like, RABL4, Rab-like protein 4 |
|---|
| Gene, Accession # | IFT27, Gene ID: 11020 |
|---|
| Catalog # | NBP1-87170 |
|---|
| Price | |
|---|
| Order / More Info | RABL4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261, 29203870 |
|---|