| Edit |   |
| Antigenic Specificity | Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (C. Elegans) (SMU1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SMU1 acts a s a suppressor of mec-8 and unc-52 homolog. |
| Immunogen | SMU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV |
| Other Names | SMU1|BWD|RP11-54K16.3|SMU-1|fSAP57|2600001O03Rik|2610203K23Rik|AB044414|AI845086|AW556129|Bwd|Smu-1|zgc:56147 |
| Gene, Accession # | Gene ID: 55234 |
| Catalog # | ABIN632943 |
| Price | |
| Order / More Info | Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (C. Elegans) (SMU1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |