| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDX23 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDX23 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX23. This antibody reacts with human. The DDX23 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human DDX23 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: REEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLM |
|---|
| Other Names | 100 kDa U5 snRNP-specific protein, DEAD (Asp-Glu-Ala-Asp) box polypeptide 23, DEAD box protein 23, EC 3.6.1, EC 3.6.4.13, MGC8416, probable ATP-dependent RNA helicase DDX23, prp28, PRP28 homolog, PRP28 homolog, yeast, PRP28p homolog, PRPF28, U5 snRNP 100 kD protein, U5-100K, U5-100kD |
|---|
| Gene, Accession # | DDX23, Gene ID: 9416 |
|---|
| Catalog # | NBP2-58799 |
|---|
| Price | |
|---|
| Order / More Info | DDX23 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|